PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_A528A05A3.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 192aa    MW: 20772.4 Da    PI: 9.988
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_A528A05A3.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.8e-10114176163
                            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +l+  +
  Traes_5DL_A528A05A3.1 114 EKEAKRLRRVLANRESARQTILRRQAVRDELARKVADLSSQNESMKKEKETVMQEYLTLQETN 176
                            89******************************************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.0E-5111178No hitNo description
SMARTSM003382.5E-11114178IPR004827Basic-leucine zipper domain
PfamPF001705.0E-9114176IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979116179IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.85E-7118172No hitNo description
CDDcd147023.54E-10119169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSDRSGQRQC RRGVSGDVEL DAAMALANMA GVSGPAALPA VHPAAPQHGG SREEEEELAS  60
TRLSLELGKV GIQASSCSSG SSAGCPSRQT RVPVAAPGGG GYGPRPRHTL TEAEKEAKRL  120
RRVLANRESA RQTILRRQAV RDELARKVAD LSSQNESMKK EKETVMQEYL TLQETNKQLK  180
EQARHHLPLP LF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669858.15e-70PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like
TrEMBLW5FWX71e-137W5FWX7_WHEAT; Uncharacterized protein
STRINGMLOC_22590.16e-77(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.12e-16bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]